PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen07g029280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 265aa    MW: 29912.5 Da    PI: 9.6814
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen07g029280.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.52.8e-313685150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krien++nrqvtf+kRrng+lKKA+ELSvLCdaev++i+fss+g+lyey+
  Sopen07g029280.1 36 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYA 85
                      79***********************************************8 PP

2K-box1095.2e-361032003100
             K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                       ++s+ s++ea+++++qqe++kL+++i+ +q+ +R+++Ge L+sLs ++L++Le +Lek++ ++RskKnell+++ie +qk+e elq++n++Lr
  Sopen07g029280.1 103 STSTGSVSEANTQYYQQEASKLRRQIRDIQTYNRQIVGEALGSLSPRDLKNLEGKLEKAIGRVRSKKNELLFSEIELMQKREIELQNANMYLR 195
                       4556669************************************************************************************** PP

             K-box  96 kklee 100
                       +k++e
  Sopen07g029280.1 196 AKIAE 200
                       **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-402887IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.0392888IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-3329104IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-323050IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003084IPR002100Transcription factor, MADS-box
CDDcd002656.33E-4233105No hitNo description
PfamPF003196.3E-263784IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-325065IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-326586IPR002100Transcription factor, MADS-box
PfamPF014864.6E-26112198IPR002487Transcription factor, K-box
PROSITE profilePS5129714.77114204IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MVFPNNQELL VDESSSQLRK TSGGTGGGGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY  60
ELSVLCDAEV SLIVFSSRGR LYEYANNSVR ATIDRYKKHH ADSTSTGSVS EANTQYYQQE  120
ASKLRRQIRD IQTYNRQIVG EALGSLSPRD LKNLEGKLEK AIGRVRSKKN ELLFSEIELM  180
QKREIELQNA NMYLRAKIAE VERAQEQMNL MPGGGGGGGG GSDHQYHHQP NYEDARNNFL  240
PVNLLEPNPH YSRRDNGDQT PLQLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A3e-2029113188Myocyte-specific enhancer factor 2A
3kov_B3e-2029113188Myocyte-specific enhancer factor 2A
3kov_I3e-2029113188Myocyte-specific enhancer factor 2A
3kov_J3e-2029113188Myocyte-specific enhancer factor 2A
3p57_A3e-2029113188Myocyte-specific enhancer factor 2A
3p57_B3e-2029113188Myocyte-specific enhancer factor 2A
3p57_C3e-2029113188Myocyte-specific enhancer factor 2A
3p57_D3e-2029113188Myocyte-specific enhancer factor 2A
3p57_I3e-2029113188Myocyte-specific enhancer factor 2A
3p57_J3e-2029113188Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0987350.0AY098735.2 Lycopersicon esculentum TAGL1 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015081658.10.0PREDICTED: floral homeotic protein AGAMOUS-like
SwissprotQ408721e-109AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLE9JUM21e-173E9JUM2_SOLLC; MADS-box transcription factor ARLEQUIN
STRINGSolyc07g055920.2.11e-169(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.13e-99MIKC_MADS family protein